PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF012200010CFD_t1
Common NameTRAES_3BF012200010CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 394aa    MW: 43175.3 Da    PI: 7.4427
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF012200010CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.81.4e-1990135147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg+WT+eEdell ++v ++G + W+tI+++++ gR +kqc++rw ++
  TRAES3BF012200010CFD_t1  90 RGPWTEEEDELLRRLVDEHGEHKWATISKHLP-GRIGKQCRERWTNH 135
                              89******************************.***********997 PP

2Myb_DNA-binding54.72.3e-17146185445
                              S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                              WT+ +d ll+da+k +G++ W+tIar+++ gR+++ +k++w+
  TRAES3BF012200010CFD_t1 146 WTEADDILLIDAHKIHGNR-WSTIARCLP-GRSENAIKNHWN 185
                              *******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.65585140IPR017930Myb domain
SMARTSM007179.3E-1989138IPR001005SANT/Myb domain
SuperFamilySSF466891.31E-3089184IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-2390138IPR009057Homeodomain-like
PfamPF002491.7E-1890135IPR001005SANT/Myb domain
CDDcd001672.20E-1792136No hitNo description
Gene3DG3DSA:1.10.10.605.4E-18139189IPR009057Homeodomain-like
PROSITE profilePS5129416.808141192IPR017930Myb domain
SMARTSM007171.9E-14142190IPR001005SANT/Myb domain
CDDcd001672.41E-13146185No hitNo description
PfamPF002495.7E-14146185IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MSADAYGRFE RYSMSSAHGF PQYQQAGNAP TGFPDTGFLV SGFGKPPTIF IMPAGTHAAA  60
GYGAEAVPVE IPVVRRQTPA SRNARATPFR GPWTEEEDEL LRRLVDEHGE HKWATISKHL  120
PGRIGKQCRE RWTNHVRPGI KKDHIWTEAD DILLIDAHKI HGNRWSTIAR CLPGRSENAI  180
KNHWNATKRS LKSKRRLKKK TSQQAAPGQF TLLEEYIRDK TMADENVAPP SPSSGLGYDG  240
QVFPNAAAML AVSTPPGMGQ YLHPADAAGS SSQAGMMNLR APLPDLNAAY SGEMLERYYY  300
PASFPTYSNN NLLHHGPEPA FPQMFSAQAR MLAACTNLKL FPLPQYLGGG YYGGETGSSS  360
AGGSSDQDED VVQMASREFQ TSDDETTLDL TGFN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C6e-39901894102C-Myb DNA-Binding Domain
1msf_C6e-39901894102C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A077RXF90.0A0A077RXF9_WHEAT; Uncharacterized protein
STRINGMLOC_14401.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.15e-35myb domain protein 118
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]